PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.196550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 361aa    MW: 40969.4 Da    PI: 6.9169
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.196550.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++ +G g+W+++++  g+ R++k+c++rw +yl
   Cucsa.196550.1 14 KGLWSPEEDEKLFNYITTFGVGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.39.6e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.196550.1  67 RGMFSQQEEDLIISLHEVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24664IPR009057Homeodomain-like
PROSITE profilePS5129424.421965IPR017930Myb domain
SuperFamilySSF466898.99E-2911108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002496.8E-141461IPR001005SANT/Myb domain
CDDcd001675.03E-101761No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2565116IPR009057Homeodomain-like
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.64566116IPR017930Myb domain
PfamPF002499.0E-1467111IPR001005SANT/Myb domain
CDDcd001672.11E-970109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRNSCCLKP KLRKGLWSPE EDEKLFNYIT TFGVGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNRWA QIAAQLPGRT DNEIKNFWNS CLKKKLMKQG  120
IDPTTHKPLE ENMEAMKDAK KNSYNNERPK MEAIHHHHHH HLHGNVSNIT EESSQHFVNK  180
IEFDSLSSYL NGEYNNNSQF ASAQYNSNIR SYDQNFFYSN SSIGMGSYSS CEHGNMSRTD  240
FSENNSASGL TSFLMNEVKE SSSNSSVVSN YSGYHMNNPG ENNNNNNGGG FSWESSENKL  300
ENLLEFQTNQ MKNLEFKGSS SVEETKIIQN QINSATFGSY PLMSMSENER AGSFGIFHHI  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-29711620128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818140.0LN681814.1 Cucumis melo genomic scaffold, anchoredscaffold00089.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138267.10.0PREDICTED: transcription factor MYB32-like
TrEMBLA0A061FTT71e-130A0A061FTT7_THECC; Myb domain protein 86
STRINGPOPTR_0015s09430.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-80myb domain protein 86